Dataset for protein Unclassified of organism Daphnia pulex

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|E9FUS6_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Daphnia pulex (length=189 residues).
MASTNWLTSKNTSQSTRESVLEQNSTFAINIVKEALGEKIDLSKDTIYRTLSTCVGEVLANCESPMQQLVNRLDLSRGVG
HDKFASLADELFEAENGYNILWERIVTLFAFTWVLSKQLHSDQIESSNNLSKILASYLNDKITPWILQQGGWIKICSEFG
EDTSASNKWKYFFLTGLGIGLVATYKLTH
© 1998-2019