Dataset for protein Unclassified of organism Daphnia magna

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A0P5E6Z1_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Daphnia magna (length=193 residues).
MKKTMASTTWLTSNNTTQPTREFVFEQNSTFAINIVKEALGEKVDLSKDKIYRTLSTCVGEVLANCESPMQQLVNRLDLS
RGIGHDKFATLADELFEAENGFIVLWERIVTLFAFTWVLSKQLHTDPVVSSSNISKILASYLNDKITPWILQEGGWIKIC
NEFGDDAAASNKWKYFFLTGLGIGLVATYKLTH
© 1998-2019