Dataset for protein BCL-2-like of organism Danio rerio

[Download (right click)] [Alignment] [Repertoires]

10 sequence(s)

>gnl|bcl2dbpro|F8W4Q8_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Danio rerio GN=MCL-1 (length=228 residues).
MFAGRNNDNGFWPCTGLQSKPLVIPELKAHNQFAVDSLQGSVPSSPSDETGDYPPTALDMDTREIIDTFLKIFTGLPHSK
SGRKQVLSTMRRVVDNLAVKHELAYKGMIARLNLEQKGEDVSFIKQVATELFSDGTTNWGRIASLLTFGAMLCKYQNDRG
HSKYVRLVGEEISSYLLTEQRDWILRNKAWDGFVEFFHVPDTEAAVRNTLLTIGGVATLSAALAYWIR
>gnl|bcl2dbpro|F8W4Q8_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Danio rerio GN=MCL-1 (length=129 residues).
MILWTLSGMIARLNLEQKGEDVSFIKQVATELFSDGTTNWGRIASLLTFGAMLCKYQNDRGHSKYVRLVGEEISSYLLTE
QRDWILRNKAWDGFVEFFHVPDTEAAVRNTLLTIGGVATLSAALAYWIR
>gnl|bcl2dbpro|Q1L8X3_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Danio rerio GN=MCL-1 (length=255 residues).
MALSLDFRRTATMSFFAQGVQTPTLKTCVEDELDGYIEEEEAPLKRLRPGTNGLKGLQLDGRFVSATDGSLPTTPDPEEL
DYAELERDTRQLLLDFYRTHTGMCPVDRKLHHAIPTMKRVVDNILVKHQIAYKGMIQRLQLDSQPASLDFIRCIASTMFK
DGVTNWGRIASLVAFGAVVCSRLKELQQDQCVERVAEQISSYLTSEQQDWILKNKSWHGFVEFFHQEDVESVVRHGLLAL
VGCAGIGAGLAFLIR
>gnl|bcl2dbpro|Q564A4_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Danio rerio GN=BCL-2 (length=228 residues).
MANEISYDNRNIVEKYLKHKLSKRGYVWKCQSSAEEDDTFNKAVEESSPNSDRRLQAPSAGGGNNSECLIARVTRSDPHL
RLYRVLRDAGDEIERIYQREFEEMSQQMVFNPNSAQRSFLTVAEELFRDGVNWGRIIAFFEFGGTMCVESVNREMASQVD
NIAHWMTDYLNGPLENWIEENGGWDAFVEMYGQQRDSVFHPFSYLTKVLGLAALGLAGVTIGAFFAQK
>gnl|bcl2dbpro|Q568V1_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Danio rerio GN=MCL-1 (length=243 residues).
MSFLAQGVQTPTLKTCVEDELDGYIEEEEAPLKRLRPGTNGLKGLQLDGRFVSTTDGSLPTTPDPEELDYAELERDTRQL
LLDFYRTHTGMCPVDRKLHHAIPTMKRVVDNILVKHQIAYKGMIQRLQLDSQPASLDFIRCIASTMFKDGVTNWGRIASL
VAFGAVVCSRLKELQQDQCVERVAEQISSYLTSEQQDWILKNKSCHGFVEFFHQEDVESVVRHGLLALVGCAGIGAGLAF
LIR
>gnl|bcl2dbpro|Q568W5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Danio rerio GN=MCL-1 (length=228 residues).
MFAGRNNDNGFWPCTGLQSKPLVIPELKAHNQFAVDSLQGSVPSSPSDETGDYPPTALDMDTREIIDTFLIIFTGLPHSK
SGRKQVLSTMRRVVDNLAVKHELAYKGMIARLNLEQKGEDVSFIKQVATELFSDGTTNWGRIASLLTFGAMLCKYQNDRG
HSKYVRLVGEEISSYLLTEQRDWILRNKAWDGFVEFFHVPDTEAAVRNTLLTIGGVATLSAALAYWIR
>gnl|bcl2dbpro|Q8UWD6_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Danio rerio GN=MCL-1 (length=228 residues).
MFAGRNNDNGFWPCTGLQSKPLVIPELKAHNQFAVDSLQGSVPSSPSDETGDYPPTALDMDTREIIDTFLKIFTGLPHSK
SGRKQVLSTMRRVVDNLAVKHELAYKGMIARLNLEQKGEDVSFIKQVATELFSDGTTNWGRIASLLTFGAMLCKYQNDRG
HSKYVRLVGEEISSYLLTEQRDWILRNKAWDGFVEFFHVPDTEAAVRNTLLTIGSVATLSAALAYWIR
>gnl|bcl2dbpro|Q90Z98_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Danio rerio GN=BCL2L1 (length=238 residues).
MSYYNRELVVFFIKYKLSQRNYPCNHIGLTEDTNRTDGAEENGEGAAGATTLVNGTMNRTNASSTGTPPQSPASSPQRQT
NGSGGLDAVKEALRDSANEFELRYSRAFNDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRIVGLFAFGGALCVECVEK
EMSPLVGRIAEWMTVYLDNHIQPWIQSQGGWERFAEIFGKDAAAESRKSQESFKKWLFAGMTLLTGVVVGGLIAQKRL
>gnl|bcl2dbpro|Q90Z98_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Danio rerio GN=BCL2L1 (length=238 residues).
MSYYNRELVVFFIKYKLSQRNYPCNHIGLTEDTNRTDGAEENGEGAAGATTLVNGTMNRTNASSTGTPPQSPASSPQRQT
NGSGGLDAVKEALRDSANEFELRYSRAFNDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRIVGLFAFGGALCVECVEK
EMSPLVGRIAEWMTVYLDNHIQPWIQSQGGWERFAEIFGKDAAAESRKSQESFKKWLFAGMTLLTGVVVGGLIAQKRL
>gnl|bcl2dbpro|Q9I9N3_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Danio rerio GN=MCL-1 (length=255 residues).
MALSLDFRRTATMSFFAQGVQTPTLKTCVEDELDGYTEEEEAPLKRLRPGTNGLKGLQLDGRFVSATDGSLPTTPDPEEL
DYAELERDTRQLLLDFYRTHTGMCPVDRKLHHAIPTMKRVVDNILVKHQIAYKGMIQRLQLDSQPASLDFIRCIASTMFK
DGVTNWGRIASLVAFGAVVCSRLKELQQDQCVERVAEQISSYLTSEQQDWILKNKSWHGFVEFFHQEDVESVVRHGLLAL
VGCAGIGAGLAFLIR
© 1998-2019