Dataset for protein Unclassified of organism Cyprinus carpio

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|B2L8N7_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cyprinus carpio (length=230 residues).
MALSLDFRRWAAGSRFQRSAAGIWLLTSCWCVLQRLRTCALVALCWPRPGTNGLKGLQLDGLVRVRGGTGSLPATPPYWE
FPLSMPARDVEQPVLLFRDQIAGMCPVDRKLHHAIPTMKRVVDNILVKHQIAYKGMIQRLQLDSQPASLDFIRCIASTMF
KDGVTNWGRIASLVAFGAVVCSRLKELQQDQCVERVAEQISSYLTSVVRHGLLALVGCAGIGAGLAFLIR
© 1998-2019