Dataset for protein Bcl-2 of organism Cyprinus carpio

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|X4ZGI8_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Cyprinus carpio GN=BCL-2 (length=229 residues).
MANEIRYDNRNIVEKYLNHKLSKKGYEWKFQSSGEDDDTINTGVEDSSPSSDRRLQAPSAGGGNNSECLIANRVTRSDPY
SRIYRSLREAGDQIERMYQREFEEMSHQMTFSPSAAQRSFLAVAEELFRDGVNWGRIVAFFEFGGTMCVESFNREMASQV
DNIAHWMTDYLNGPLENWIEENGGWDAFVELYSQQRDPMFHPLSYLTKVLGLAALGLAGVTIGAFFAQK
© 1998-2019