Dataset for protein Unclassified of organism Cyprinodon variegatus

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A3Q2DJ96_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Cyprinodon variegatus (length=227 residues).
MANDCNRNIVENYIFHKLSKRGYVWEFNGEDGAADNGGLGDHSPTLVRRCRDAGAGPQSDSDPRRLCRRLSGSDPRADIH
RVLRDAGDELERLYQLDFVEMSQQLYLTRDTARTRFAEVIDELFRDGVNWGRIIAFFEFGSTVCVECASKEEMLSQVDNI
AEWMTEYLNGTLDSWIQDNGGWEAFVELYDRQKESILSCYWPSIKTVFGLAALGAASITIGAYLAQK
>gnl|bcl2dbpro|A0A3Q2G0M1_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Cyprinodon variegatus (length=202 residues).
MAAYSSRDIIEGYLRCKLLDGGVAWRFPKQRHFQFPWRSEEGGAPGPLQLALPRLLAALRNASDELEGRYGSSLHGQVAA
LRHRELGGAAARQSLALIRDELFRDGVNWGRIVAMMALGGALSAQAARTGETGQVDDIADWMEESLEAAALRTWIHDNGG
WEAFVEMYECRPPDTFWSLRTVFGMVVLGAAFITLGLLLAQR
© 1998-2019