Dataset for protein Mcl-1 of organism Cyprinodon variegatus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3Q2EDX8_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cyprinodon variegatus GN=MCL-1 (length=264 residues).
MSYLILPQNGVVDGQTHYSPEIAAPEIPMNSPMGSLHRNLMKRPKDLQVATNGYVGKNLSDNSADDGGSLPCTPEMPTDS
HPATPGGHAGDEALDNDTKELISSFLRDFTGLPKQRRNQTKALSTMKRVVEDVLSKHRYAYNGMMNKLCLDEVPDNMGFV
SSVATSLFSDGTTNWGRIVSLVAFGAVVCQHLKEKGRENCVELVSQEISTYLLQNQRDWLVKNNSWNGFVEFFRVEDPEA
TMRNTLMAFVGVAGIGATLAFLIR
© 1998-2019