Dataset for protein BCL-2-like of organism Cyprinodon variegatus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A3Q2C6K4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Cyprinodon variegatus GN=BCL2L1 (length=219 residues).
MSYSNRELVEFYISYKLSQTNCPNSLLRSEVTGGRTEGDKDASASSNGPLFNSRPSPPGKPRAPHGSIEAVKSALKDSAN
EFELLFSQSFSDLSMQLDITPDTAYHSFKAVLDELFKDGINWGRVVGLFAFGGVLCVHCVQKNMSELVSRIADWMTIYLD
EQLNPWIHSQGGWDCFAKLYGQDAAAEGRRSHETLNKWLLVGAALLGGVLLTVLVAKKR
>gnl|bcl2dbpro|A0A3Q2EDX8_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cyprinodon variegatus GN=MCL-1 (length=264 residues).
MSYLILPQNGVVDGQTHYSPEIAAPEIPMNSPMGSLHRNLMKRPKDLQVATNGYVGKNLSDNSADDGGSLPCTPEMPTDS
HPATPGGHAGDEALDNDTKELISSFLRDFTGLPKQRRNQTKALSTMKRVVEDVLSKHRYAYNGMMNKLCLDEVPDNMGFV
SSVATSLFSDGTTNWGRIVSLVAFGAVVCQHLKEKGRENCVELVSQEISTYLLQNQRDWLVKNNSWNGFVEFFRVEDPEA
TMRNTLMAFVGVAGIGATLAFLIR
>gnl|bcl2dbpro|A0A3Q2FR43_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Cyprinodon variegatus GN=BCL2L1 (length=226 residues).
MSQNRELVLFYIKFKLSQRNYPVNHIMLNEPPNGTGAQGAEQDDERTPETHANGTFNGTSPGSPRRQQASTAAMEAVKAA
LRDTACEFELRYARAFNDLHSTLHITPATAYQSFENVMNEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGRIVEW
MTVYLDEQIDPWIQSQGGWERFAEIFGGDAAAESRRSQESLKNWLLLGMSVATALIAGSIFAHKRL
>gnl|bcl2dbpro|A0A3Q2GL87_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Cyprinodon variegatus GN=BCL2L10 (length=206 residues).
MCREPLHITGRKMSCGLWKETVAVAEDYMRLRCSSPLPAPPPPSEPAAAMRRLAQDMETQHQARFHTLAQSFLRHSGTDL
CSSLRKVMDEMVGDGLFNWGRVVSLFTFAGVLARQLQEQTGKNPGLDPGRQQELQTEPVSCRALAETIADYLETHKKDWL
QENNGWDGFCNYARNAREVSQDSSMKTALVAVAGVGIAGLTFLLVR
© 1998-2019