Dataset for protein Unclassified of organism Cynoglossus semilaevis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3P8W0Y8_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cynoglossus semilaevis (length=190 residues).
MPSNGQWVSMGKARNSGDQARRSQRWDQALNKETRQLMKQFLGESMGLLKCSREESEALSTMKRVTARLLEKYGNAYNGM
IGNLPVDDRGDKVISTGAVARAIFADGTTNWGHIVSLVALGVVVCRHYNEKEEGLDFVESVGDEISTYLMTEEGLADGFV
KFFAEPKRISTLGFCVRVATIGLLISLTAI
© 1998-2019