Dataset for protein Mcl-1 of organism Cynoglossus semilaevis

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A3P8V8T6_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cynoglossus semilaevis GN=MCL-1 (length=193 residues).
LDMVLISSVCLTLCTLENDTRQLICDFLKDFTTKSTQRLVESKALSTMKRVVKGILDKHRHAFSGMINNLSFENGVYNIG
VVGAVARSLFRDGTSNWGRIVSLVAFGAVLCQHLKEKGWENTVDQVGQEIASYLLSYQKDWLLKNNSWDGFVEFFQGQEP
EKAIRCTLLGFVGFAGLWATLALLMRYFLRFVW
>gnl|bcl2dbpro|A0A3P8VKS9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cynoglossus semilaevis GN=MCL-1 (length=285 residues).
MNIIKNNQAKLNVATGVLGCFIVPQNGVVNGTMHYGTGNSTPIALASSLSTHNDSMSSVTETQRRPKDLQVNTANGHARK
SHCEVDEGSEPCTPEPHSEAELDVSQAGDEVLDTDTKELIFQFYRDFTTHSPSKWGERKALTTMKRVVDDVLEKHRYAYN
GMINKLSLENRQGDLTFISSVAKSLFGDGTTNWGRITSLVAFGAVVCQHLKECGQENSTELVGREISSYLLSYQRDWLLK
NNSWDGFVEFFRVEDPEATMRNTLLGLFGVAGLGATLALLIRSRK
>gnl|bcl2dbpro|A0A3P8VKS9_MCL1-05 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cynoglossus semilaevis GN=MCL-1 (length=284 residues).
MNIIKNNQAKLNVATGVLGCFIVPQNGVVNGTMHYGTGNSTPIALASSLSTHNDSMSSVTETQRRPKDLQVNTANGHARK
SHCEVDEGSEPCTPEPHSEAELDVSQAGDEVLDTDTKELIFQFYRDFTTHSPSKWGERKALTTMKRVVDDVLEKHRYAYN
GMINKLSLENRQGDLTFISSVAKSLFGDGTTNWGRITSLVAFGAVVCQHLKECGQENSTELVGREISSYLLSYQRDWLLK
NNSWDGFVEFFRVEDPEATMRNTLLGLFGVAGLGATLALLIRWK
>gnl|bcl2dbpro|A0A3P8VKS9_MCL1-04 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cynoglossus semilaevis GN=MCL-1 (length=282 residues).
MNIIKNNQAKLNVATGVLGCFIVPQNGVVNGTMHYGTGNSTPIALASSLSTHNDSMSSVTETQRRPKDLQVNTANGHARK
SHCEVDEGSEPCTPEPHSEAELDVSQAGDEVLDTDTKELIFQFYRDFTTHSPSKWGERKALTTMKRVVDDVLEKHRYAYN
GMINKLSLENRQGDLTFISSVAKSLFGDGTTNWGRITSLVAFGAVVCQHLKECGQENSTELVGREISSYLLSYQRDWLLK
NNSWDGFVEFFRVEDPEATMRNTLLGLFGVAGLGATLALLIR
>gnl|bcl2dbpro|A0A3P8VKS9_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cynoglossus semilaevis GN=MCL-1 (length=282 residues).
MNIIKNNQAKLNVATGVLGCFIVPQNGVVNGTMHYGTGNSTPIALASSLSTHNDSMSSVTETQRRPKDLQVNTANGHARK
SHCEVDEGSEPCTPEPHSEAELDVSQAGDEVLDTDTKELIFQFYRDFTTHSPSKWGERKALTTMKRVVDDVLEKHRYAYN
GMINKLSLENRQGDLTFISSVAKSLFGDGTTNWGRITSLVAFGAVVCQHLKECGQENSTELVGREISSYLLSYQRDWLLK
NNSWDGFVEFFRVEDPEATMRNTLLGLFGVAGLGATLALLIR
>gnl|bcl2dbpro|A0A3P8VKS9_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cynoglossus semilaevis GN=MCL-1 (length=304 residues).
MNIIKNNQAKLNVATGVLGCFIVPQNGVVNGTMHYGTGNSTPIALASSLSTHNDSMSSVTETQRRPKDLQVNTANGHARK
SHCEVDEGSEPCTPEPHSEAELDVSQAGDEVLDTDTKELIFQFYRDFTTHSPSKWGERKALTTMKRVVDDVLEKHRYAYN
GMINKLSLENRQGDLTFISSVAKSLFGDGTTNWGRITSLVAFGAVVCQHLKECGQENSTELVGREISSYLLSYQRDWLLK
NNSWDGFVEFFRVEDPEATMRNTLLGLFGVAGLGATLALLIRDFNSIGKAFTVAFDAMFLFIRR
© 1998-2019