Dataset for protein BCL-2-like of organism Cynoglossus semilaevis

[Download (right click)] [Alignment] [Repertoires]

10 sequence(s)

>gnl|bcl2dbpro|A0A3P8UWG7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Cynoglossus semilaevis GN=BCL2L1 (length=235 residues).
TLTFNINRKLVVDYIQYKLSQRNFPVHHLGLGDSPNRTDGEEAGLGAEQRTSTHANGTVNGTSSGTPPASPLRQQHSASD
TSLDSIKEALRDSANEFELRYARAFSDLHQQLHITPATAYQSFENVMDEVFRDGVNWGRIIGLFAFGGALSVECVEKEMS
QLVARIADWMTVYLDNHIQPWIETQGGWEHFAELFGQDAAAESRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3P8V8T6_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cynoglossus semilaevis GN=MCL-1 (length=193 residues).
LDMVLISSVCLTLCTLENDTRQLICDFLKDFTTKSTQRLVESKALSTMKRVVKGILDKHRHAFSGMINNLSFENGVYNIG
VVGAVARSLFRDGTSNWGRIVSLVAFGAVLCQHLKEKGWENTVDQVGQEIASYLLSYQKDWLLKNNSWDGFVEFFQGQEP
EKAIRCTLLGFVGFAGLWATLALLMRYFLRFVW
>gnl|bcl2dbpro|A0A3P8VKS9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cynoglossus semilaevis GN=MCL-1 (length=285 residues).
MNIIKNNQAKLNVATGVLGCFIVPQNGVVNGTMHYGTGNSTPIALASSLSTHNDSMSSVTETQRRPKDLQVNTANGHARK
SHCEVDEGSEPCTPEPHSEAELDVSQAGDEVLDTDTKELIFQFYRDFTTHSPSKWGERKALTTMKRVVDDVLEKHRYAYN
GMINKLSLENRQGDLTFISSVAKSLFGDGTTNWGRITSLVAFGAVVCQHLKECGQENSTELVGREISSYLLSYQRDWLLK
NNSWDGFVEFFRVEDPEATMRNTLLGLFGVAGLGATLALLIRSRK
>gnl|bcl2dbpro|A0A3P8VKS9_MCL1-05 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cynoglossus semilaevis GN=MCL-1 (length=284 residues).
MNIIKNNQAKLNVATGVLGCFIVPQNGVVNGTMHYGTGNSTPIALASSLSTHNDSMSSVTETQRRPKDLQVNTANGHARK
SHCEVDEGSEPCTPEPHSEAELDVSQAGDEVLDTDTKELIFQFYRDFTTHSPSKWGERKALTTMKRVVDDVLEKHRYAYN
GMINKLSLENRQGDLTFISSVAKSLFGDGTTNWGRITSLVAFGAVVCQHLKECGQENSTELVGREISSYLLSYQRDWLLK
NNSWDGFVEFFRVEDPEATMRNTLLGLFGVAGLGATLALLIRWK
>gnl|bcl2dbpro|A0A3P8VKS9_MCL1-04 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cynoglossus semilaevis GN=MCL-1 (length=282 residues).
MNIIKNNQAKLNVATGVLGCFIVPQNGVVNGTMHYGTGNSTPIALASSLSTHNDSMSSVTETQRRPKDLQVNTANGHARK
SHCEVDEGSEPCTPEPHSEAELDVSQAGDEVLDTDTKELIFQFYRDFTTHSPSKWGERKALTTMKRVVDDVLEKHRYAYN
GMINKLSLENRQGDLTFISSVAKSLFGDGTTNWGRITSLVAFGAVVCQHLKECGQENSTELVGREISSYLLSYQRDWLLK
NNSWDGFVEFFRVEDPEATMRNTLLGLFGVAGLGATLALLIR
>gnl|bcl2dbpro|A0A3P8VKS9_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cynoglossus semilaevis GN=MCL-1 (length=282 residues).
MNIIKNNQAKLNVATGVLGCFIVPQNGVVNGTMHYGTGNSTPIALASSLSTHNDSMSSVTETQRRPKDLQVNTANGHARK
SHCEVDEGSEPCTPEPHSEAELDVSQAGDEVLDTDTKELIFQFYRDFTTHSPSKWGERKALTTMKRVVDDVLEKHRYAYN
GMINKLSLENRQGDLTFISSVAKSLFGDGTTNWGRITSLVAFGAVVCQHLKECGQENSTELVGREISSYLLSYQRDWLLK
NNSWDGFVEFFRVEDPEATMRNTLLGLFGVAGLGATLALLIR
>gnl|bcl2dbpro|A0A3P8VKS9_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cynoglossus semilaevis GN=MCL-1 (length=304 residues).
MNIIKNNQAKLNVATGVLGCFIVPQNGVVNGTMHYGTGNSTPIALASSLSTHNDSMSSVTETQRRPKDLQVNTANGHARK
SHCEVDEGSEPCTPEPHSEAELDVSQAGDEVLDTDTKELIFQFYRDFTTHSPSKWGERKALTTMKRVVDDVLEKHRYAYN
GMINKLSLENRQGDLTFISSVAKSLFGDGTTNWGRITSLVAFGAVVCQHLKECGQENSTELVGREISSYLLSYQRDWLLK
NNSWDGFVEFFRVEDPEATMRNTLLGLFGVAGLGATLALLIRDFNSIGKAFTVAFDAMFLFIRR
>gnl|bcl2dbpro|A0A3P8VMA1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Cynoglossus semilaevis GN=BCL2L1 (length=214 residues).
MSCSNRELVKFFLGYKLSQRNYPESLLMLRIGGEQREGEEVTTASSNGVPQTPSAVLQHCSGAEAVKAALKDSADEFELR
FTQAFRNLFLKLDLTPDTVYHSFKSVMDEVFRDGVNWGRIVGLFTFGGVLCVECVQRNMSELVPRIADWMTMYLDEYIDP
WIQSQGGWDRFAEIFGTDCIPRTRSCRDTVRRWLLVGAGLLAAVLIGVLITKKH
>gnl|bcl2dbpro|A0A3P8W7K5_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Cynoglossus semilaevis GN=BCL2L10 (length=217 residues).
MCNSASPSAVSTSSEQSDIAGRKMSCGLWKETLAVAEDYLSLCCSSPRPAPPPPSESAAAMRHLAQDMEKQHQARFQTLS
QSFLRQCGSEPCVCLRKVMEELVGDGHLNWGRVVSIFTFTGVLAKQLLVQKGLKPGQEPEAGQELGPEPGTCRELAETIA
DYLGEEKKAWLLENGGWEGFCEFSHSARELSQDSSMKTALFAAASVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A3P8WUE9_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Cynoglossus semilaevis GN=BCL-2 (length=237 residues).
MYLVPNSAGMASECNRYIVEKYICHKLAKRGYVWEHDEDRDGDAANNGSIVSRPPTLVHRCRGASTGPGNDGIPNLCKRP
PAPEAHAAIHRVLREAGDELERLYQPDFSEMSRQLYLTSSTAQRRFTEVIDELFRDGVNWGRIIAFFEFGGVVCVECAAK
EDLTPQVEQVVDWMTEYLNGPLNIWIKENGGWDAFVELYDRQGESAFSCSWPSIKTVFGLAALGAASLTIGAYLTQK
© 1998-2019