Dataset for protein Bcl-xL of organism Cynoglossus semilaevis

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3P8UWG7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Cynoglossus semilaevis GN=BCL2L1 (length=235 residues).
TLTFNINRKLVVDYIQYKLSQRNFPVHHLGLGDSPNRTDGEEAGLGAEQRTSTHANGTVNGTSSGTPPASPLRQQHSASD
TSLDSIKEALRDSANEFELRYARAFSDLHQQLHITPATAYQSFENVMDEVFRDGVNWGRIIGLFAFGGALSVECVEKEMS
QLVARIADWMTVYLDNHIQPWIETQGGWEHFAELFGQDAAAESRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A3P8VMA1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Cynoglossus semilaevis GN=BCL2L1 (length=214 residues).
MSCSNRELVKFFLGYKLSQRNYPESLLMLRIGGEQREGEEVTTASSNGVPQTPSAVLQHCSGAEAVKAALKDSADEFELR
FTQAFRNLFLKLDLTPDTVYHSFKSVMDEVFRDGVNWGRIVGLFTFGGVLCVECVQRNMSELVPRIADWMTMYLDEYIDP
WIQSQGGWDRFAEIFGTDCIPRTRSCRDTVRRWLLVGAGLLAAVLIGVLITKKH
© 1998-2019