Dataset for protein Bcl-2 of organism Cynoglossus semilaevis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3P8WUE9_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Cynoglossus semilaevis GN=BCL-2 (length=237 residues).
MYLVPNSAGMASECNRYIVEKYICHKLAKRGYVWEHDEDRDGDAANNGSIVSRPPTLVHRCRGASTGPGNDGIPNLCKRP
PAPEAHAAIHRVLREAGDELERLYQPDFSEMSRQLYLTSSTAQRRFTEVIDELFRDGVNWGRIIAFFEFGGVVCVECAAK
EDLTPQVEQVVDWMTEYLNGPLNIWIKENGGWDAFVELYDRQGESAFSCSWPSIKTVFGLAALGAASLTIGAYLTQK
© 1998-2019