Dataset for protein BCL-2-like of organism Ctenopharyngodon idella

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A345BSW9_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Ctenopharyngodon idella GN=BCL2L1 (length=208 residues).
MSYYNRELVVFFIKYKLSQRNYPCNHIGLTEDTNRTDGAEENGEGAAGTTTLVNGSMNRTPPQSPATSPQHQTNGSGGLD
AVKEALRDSANEFELRYSRAFNDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVG
RIAEWMTVYLDNHIQPWIQSQGGWVSGKLLAFLSYLVPFLQFNHKEPL
© 1998-2019