Dataset for protein Bcl-2 of organism Cricetulus longicaudatus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q923R6_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Cricetulus longicaudatus GN=BCL-2 (length=236 residues).
MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDVGDVDAAPLGAAPTPGIFSFQPESNPTPAVHRDMAARTSPLRPIVATTG
PTLSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVN
REMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSVRPLFDFSWLSLXTLLNLALVGACITLGTYLGHK
© 1998-2019