Dataset for protein Unclassified of organism Crassostrea gigas

[Download (right click)]

4 sequence(s)

>gnl|bcl2dbpro|K1PS96_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Crassostrea gigas (length=799 residues).
MPPPSEQEIKAEVRKILEQFLKKQLLNNNEEESAIPTGFQRVSVEDVVETDGPGSTSTSREGSRYSSKTSCARCRSEASQ
SIPTSSIRSLTDNTIDFPFIDEDENEVDHSDKDHSERSKSLPSNILSSVKIQDKNSLALSKSLSPTKLREVINNGPPLNK
ASEKGDRELSLYSSEDFLQTGSGLKDIEEIGISRGRQRLKSGTESGTDDTDYEEEVISPNRKKKSIFTRLKERMNRSLSR
GRIKENEENKRTRSRSEGSVIIKRRKPRKKKDIGSSVDKVSDVVQNVHTHKHGHVEQHHYSNGNKSGMLMESEVWESTDV
TGESEHKHEERHSNIRESKEQPSDGENGIMRRLKKMTSFKKSKKNKSDSPSSKASKSDEVDFDHKRPKSPKTDFGRSVSS
GQGYQERVHMNGDHSRQTTTTTVVTGTQIQGCTDENLPEGPIKGEVMDLAKKNKSFVLDFETCERQQRRLLPDGSFDTTV
QQHVKVKHFDEGHDIEVDGTEDQAMCPRHAASGQPNPEKDRLYTAVAEKLAHIGDHYMATSPLSDSTSSSVDHTATRRVS
ARTPNLPGVDERDSDGLTQLERQLRDKFREVGDTFSLDISPDSVKDAAMEIAKQATYQKFQEVVDNKIGPGNSWDQIAAV
FYLTKKAVTLAGVGGAVALQVKDLAAEYVADKFATWIVDQGGWGKHLSVLAPPELNENITVKINFSKCYNVRGTQQILHM
EQGPRSKILEVFRINTYSNSPGTNRNCLWMGGGFTIDNHTTVTFSSSRGRPIPDSVCRSTSFTDFPDEYLHIRLQELSR
>gnl|bcl2dbpro|K1PWI6_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Crassostrea gigas (length=146 residues).
MDRLGTRYIVTDYLNHRLSKNGHTWTHCPPLLDPPLKIHTTMRDKGDEFEELYKVQFQDLVDQLHVTHDTCYPMFKAVVE
ELFQGGTNWGRVVALFAFSGSLATRCVEKGMAGLVDSIVDWVTQFIEQDLRQWIDQHGGWVGYHRE
>gnl|bcl2dbpro|K1QHH5_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Crassostrea gigas (length=227 residues).
MATEIENIKHSSGNYLKGNLFSEINRQLGILPGFAGLGQDMTKLDQETQTPGSTTPMDKVRQTAEVIASDVIATFEDDST
KTPQNRYCKTMRRTVKEMSDRHNIAFKSMVQKLNVNDTNAFSTFVSVADEIFEDGTINWGRIVAVYTFASRLAAHCKKHN
PESEERIALYAGKYVASKLGKWILDNGGWDAFSDYFPEQGATEDKLWKGLMFTAVGLVTLGTMVARS
>gnl|bcl2dbpro|K1R9D6_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Crassostrea gigas (length=205 residues).
MATELENIKHSNGTYLKGNLFSEINRQLGILPGFAGLGQDMTKLDQETQTPGSTTPMDKVRQTAEVIASDVIATFEDDST
KTPQNRYCKTMRRTVKEMSDRHNFAFKSMVQKLNVNDTNAFSTFVSVADEIFEDGTINWGRIVAVYTFASRLAADCKKHN
PESEERIALYAGKYVASKLGKWILDNGGWVSIDLNVNCNLKRSLV
© 1998-2019