Dataset for protein BCL-2-like of organism Coregonus lavaretus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A0U3DHY6_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Coregonus lavaretus GN=BCL-2 (length=227 residues).
MANENPYDSRFIVEKYIHNKLLKKGFVWEFQAENDSPNNLFGDPSTPNTPEVFARRSQPTAAVEDTDSPFQNRSPQPDPH
VRLHRVLREAGDEIERMYLRDFAEMSGQLHFTPSTAQXRFTAVIDELFSDGVNWGRIVAFFEFGGTMCVESVNREMTSQV
DNIALWMTEYLNGPLQNWIQENGGWDAFVEIYEQQRISHSWPYLKTVFGLAALGAVGVTIGALFTQK
© 1998-2019