Dataset for protein Mcl-1 of organism Colobus angolensis palliatus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A2K5I9Q7_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Colobus angolensis palliatus GN=MCL-1 (length=197 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATGAKDTQPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLR
KLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWD
GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A2K5I9Q7_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Colobus angolensis palliatus GN=MCL-1 (length=349 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGTVIGGSAGASPPAALTPDARRVARPP
PIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESNSSSTDGSLP
STPPPAEEEEDELYRQSLEIISRYLREQATGAKDTQPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNED
DVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHV
EDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A2K5I9Q7_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Colobus angolensis palliatus GN=MCL-1 (length=270 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGTVIGGSAGASPPAALTPDARRVARPP
PIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESNSSSTDGSLP
STPPPAEEEEDELYRQSLEIISRYLREQATGAKDTQPMGRSGATSRKALETLRRVGDGVQRNHETAFQGWVCGVLPCRGP
RRWHQKCAAGFCRCCWSRSWFGISNQIALL
© 1998-2019