Dataset for protein BCL-2-like of organism Colobus angolensis palliatus

[Download (right click)] [Alignment] [Repertoires]

11 sequence(s)

>gnl|bcl2dbpro|A0A2K5H963_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Colobus angolensis palliatus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K5H963_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Colobus angolensis palliatus GN=BCL2L1 (length=145 residues).
MWKRTGLRPQKGLNRRWRPPVPSMATHPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAT
WMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K5HEK7_BCL2L2-03 BCL2-like 2 protein OS=[Eukaryota] Colobus angolensis palliatus GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A2K5HEK7_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Colobus angolensis palliatus GN=BCL2L2 (length=333 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVY
RGRARATSWYSPY
>gnl|bcl2dbpro|A0A2K5HK49_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Colobus angolensis palliatus GN=BCL-2 (length=239 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAATPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLPTPAAPAA
AAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMWPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A2K5I9Q7_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Colobus angolensis palliatus GN=MCL-1 (length=197 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATGAKDTQPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLR
KLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWD
GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A2K5I9Q7_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Colobus angolensis palliatus GN=MCL-1 (length=349 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGTVIGGSAGASPPAALTPDARRVARPP
PIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESNSSSTDGSLP
STPPPAEEEEDELYRQSLEIISRYLREQATGAKDTQPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNED
DVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHV
EDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A2K5I9Q7_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Colobus angolensis palliatus GN=MCL-1 (length=270 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGTVIGGSAGASPPAALTPDARRVARPP
PIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESNSSSTDGSLP
STPPPAEEEEDELYRQSLEIISRYLREQATGAKDTQPMGRSGATSRKALETLRRVGDGVQRNHETAFQGWVCGVLPCRGP
RRWHQKCAAGFCRCCWSRSWFGISNQIALL
>gnl|bcl2dbpro|A0A2K5K3B0_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Colobus angolensis palliatus GN=BCL2L10 (length=204 residues).
MADQLRERTNVADPLRERTERLLADYLGCCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSAYLGYPGNRVELVAL
MAEAVLSDSPGPTWGRVVSLVTFAGTLLEREPLVTAWWKKRSFQPRLKEQEGDVARDCQRLVALLSSRLAGQHRAWLQAQ
GGWDGFCHFFRTPFPLAFWRKLLIQAFLACLLTTAFGYLWTRLL
>gnl|bcl2dbpro|A0A2K5KAB6_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Colobus angolensis palliatus GN=BCL2A1 (length=175 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQEEVEKNLKPCLDNVNVASIDTARTIFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEV
TGKICEMLSLLKQYC
>gnl|bcl2dbpro|A0A2K5KAB6_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Colobus angolensis palliatus GN=BCL2A1 (length=163 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQEEVEKNLKPCLDNVNVASIDTARTIFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGKWHNHMPMLVESVAHKKKK
MAL
© 1998-2019