Dataset for protein Unclassified of organism Chondrosia reniformis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2D3E532_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Chondrosia reniformis (length=224 residues).
MANVSGELPSSGQAPKLTLNDTSNLSALIVVTFLKDILEEHYYEGLVKGITDQKRFRELTERENIRNMVQKVTGKLKAIM
AKFPESNVTSVRQRCSRLDIHQANASAKYHVTAQHLFHDGITWGRLALFYSFTASFCVYVAESQMEDLVDSTIEWCLALQ
HSRLDPWILQSHGWDGFVEYADKALGEKPRVNEDDETHFHFSGKLVAAAAVIGAAALASFFGSR
© 1998-2019