Dataset for protein BCL-2-like of organism Chlorocebus sabaeus

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A0D9RG38_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Chlorocebus sabaeus GN=BCL2L10 (length=193 residues).
MADPLRERTERLLADYLGCCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSAYLGYPGNRVELVALMADAVLSDSP
GPTWGRVVSLVTFAGTLLEREPLMTAWWKKQSFQPRLEQEGDVARDCQRLVALLSSRLAGQHRAWLQAQGGWDGFCHFFR
SPFPLAFWRKLLIQAFLACLLATAFGYLWTRLL
>gnl|bcl2dbpro|A0A0D9RJZ8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Chlorocebus sabaeus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREV
IPMAAVKQTLREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A0D9RRC3_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Chlorocebus sabaeus GN=BCL2A1 (length=175 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVASSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFITNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEV
TGKICEMLSLLKQYC
>gnl|bcl2dbpro|A0A0D9RU30_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Chlorocebus sabaeus GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A0D9RZP5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Chlorocebus sabaeus GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGTVIGGSAGASPPAALTPDARRVARPP
PIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNSSSTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMSRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A0D9S017_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Chlorocebus sabaeus GN=BCL-2 (length=239 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAATPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLPTPAAPAA
AAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
© 1998-2019