Dataset for protein Bfl1 of organism Chlorocebus sabaeus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A0D9RRC3_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Chlorocebus sabaeus GN=BCL2A1 (length=175 residues).
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVASSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFITNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEV
TGKICEMLSLLKQYC
© 1998-2019