Dataset for protein Mcl-1 of organism Cercocebus atys

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A2K5LXU8_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cercocebus atys GN=MCL-1 (length=271 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGTVIGGSAGASPPAALTPDARRVARPP
PIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNSPSTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGWVCGVLPCRG
PRRWHQKCAAGCCRCCWSRSWFGISNKIALL
>gnl|bcl2dbpro|A0A2K5LXU8_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cercocebus atys GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGTVIGGSAGASPPAALTPDARRVARPP
PIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNSPSTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAVAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A2K5LXU8_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cercocebus atys GN=MCL-1 (length=197 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLR
KLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWD
GFVEFFHVEDLEGGIRNVLLAVAGVAGVGAGLAYLIR
© 1998-2019