Dataset for protein Bcl-w of organism Cebus capucinus imitator

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A2K5RUN8_BCL2L2-03 BCL2-like 2 protein OS=[Eukaryota] Cebus capucinus imitator GN=BCL2L2 (length=346 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVDVKAFIYSSLTQVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRF
YSGFNSRPRGRVYRGRARATSWYSPY
>gnl|bcl2dbpro|A0A2K5RUN8_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Cebus capucinus imitator GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
© 1998-2019