Dataset for protein Mcl-1 of organism Cavia porcellus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A286Y1M5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cavia porcellus GN=MCL-1 (length=233 residues).
MSPEEELDGYEPEPLGKRPAVLPLLGLVGEAGKSPSADGSLPSTPPPAEEEEEEDALYRQSLEIISRYLREQAAGAKDSK
PLGGVGPTSRKALETLRRVGDGVQRNHQTAFQGMLRKLDIKNEDDVKSLSRVVALVFSDGVTNWGRIVTLISFGAFVAKH
LKSINQESCIEPLAESITDALVHSKRDWLVKQRGWDGFVEFFHIEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
© 1998-2019