Dataset for protein BCL-2-like of organism Cavia porcellus

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A286XQQ9_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Cavia porcellus GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMQPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A286XUI2_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Cavia porcellus GN=BCL2A1 (length=202 residues).
MGHILLSATAGSLDLREPAAGCCLPPRMIDLEFRYTQALAQDYLLHVLQVPQCETSPSKASKVLQDMALSVQEEVERRLK
PWLDRIDVESIDTAKSIFNQVMEKEFEDGIINWGRIVTIFAFGGVILKKLPREPIAPDVDTYKEISYFVAEFIMSRMGGW
IRQNGGWDNGFVRKFEPKSGWLTFVGVMGQLCEMLSLLKQFY
>gnl|bcl2dbpro|A0A286Y1M5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cavia porcellus GN=MCL-1 (length=233 residues).
MSPEEELDGYEPEPLGKRPAVLPLLGLVGEAGKSPSADGSLPSTPPPAEEEEEEDALYRQSLEIISRYLREQAAGAKDSK
PLGGVGPTSRKALETLRRVGDGVQRNHQTAFQGMLRKLDIKNEDDVKSLSRVVALVFSDGVTNWGRIVTLISFGAFVAKH
LKSINQESCIEPLAESITDALVHSKRDWLVKQRGWDGFVEFFHIEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A286Y5D6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Cavia porcellus GN=BCL2L1 (length=233 residues).
MSQSNWELVVDFLSYKLSQKGYSWSQFSDVEENRTEGPEGTESEMETPSAINGNPSWHLTDSPTVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVRRIASWMATYLNDHLEPWIQDNGGWDTFVELYGNNAAAESRKGQERFNRWLLTGVTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|H0W1T3_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Cavia porcellus GN=BCL-2 (length=183 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDGSALGRNSPLGVPRDPAARTSPPPPLAGLAVAQGPALSPVPPVVHL
TLRQAGDDFSRRYRQDFAEMSSQLHLTPFTARGRFATLFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTE
YLNRHLHTWIQDNGGWVGACLSE
© 1998-2019