Dataset for protein Bcl-2 of organism Cavia porcellus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|H0W1T3_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Cavia porcellus GN=BCL-2 (length=183 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDGSALGRNSPLGVPRDPAARTSPPPPLAGLAVAQGPALSPVPPVVHL
TLRQAGDDFSRRYRQDFAEMSSQLHLTPFTARGRFATLFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTE
YLNRHLHTWIQDNGGWVGACLSE
© 1998-2019