Dataset for protein Unclassified of organism Capra hircus

[Download (right click)]

3 sequence(s)

>gnl|bcl2dbpro|A0A452EQI5_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Capra hircus (length=169 residues).
TSLPLHSLHITLGTAYQSFEQVVCELFLDRVNWGHIVAFFSFGGALSMESTDKEMQVLVSQLTTWMATYLNGHLEPWIQE
NSGWDTFVELYRNNTATESQKGQECFNRWPLTGMTVAGLVVLNSLSFCLSVKLLISPSYLNEILAGYSNLGCRLLSFITL
SMSCHSLLA
>gnl|bcl2dbpro|A0A452EQI5_uncBCL2L1-02 Putative BCL2-like 1 protein OS=[Eukaryota] Capra hircus (length=206 residues).
NAINGNPSWHLAGSPAVNGATGHSRSLDAREVIPMATVKQALRELHITLGTAYQSFEQVVCELFLDRVNWGHIVAFFSFG
GALSMESTDKEMQVLVSQLTTWMATYLNGHLEPWIQENSGWDTFVELYRNNTATESQKGQECFNRWPLTGMTVAGLVVLN
SLSFCLSVKLLISPSYLNEILAGYSNLGCRLLSFITLSMSCHSLLA
>gnl|bcl2dbpro|A0A452FLQ5_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Capra hircus (length=142 residues).
MWKRTELRAQKGQYQIWKPQMPSMTTHLGTAYQSFEQEMYELFRDGVNWDSWPFFLLVGHCVESIDKEMQVLVSQITTWM
ATYLNDHLEPWIQENGGWNTFVKLYGNNTAAKSQKGQGRFNRWSLIGMTSAGIALLGSLFSS
© 1998-2019