Dataset for protein Mcl-1 of organism Capra hircus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A452GAH0_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Capra hircus GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGKEATARREVGGGEAGTVIGGSAGPSPPATLAPDARRVARPSP
IGAEGPDVTATPTRLLFFAPTRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPAVRPLALMVGEASNNSPGSDGSL
PSTPPPSEEEEDELYRQSLEIISQYLLEQATGAKDAKPLGGSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRSKRDWIVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A452GAH0_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Capra hircus GN=MCL-1 (length=335 residues).
MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGKEATARAGPSPPATLAPDARRVARPSPIGAEGPDVTATPTRL
LFFAPTRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPAVRPLALMVGEASNNSPGSDGSLPSTPPPSEEEEDELY
RQSLEIISQYLLEQATGAKDAKPLGGSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFS
DGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRSKRDWIVKQRGWDGFVEFFHVEDLEGGIRNVLLAF
AGVAGVGAGLAYLIR
© 1998-2019