Dataset for protein BCL-2-like of organism Capra hircus

[Download (right click)] [Alignment] [Repertoires]

11 sequence(s)

>gnl|bcl2dbpro|A0A076FU27_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Capra hircus GN=BCL-2 (length=229 residues).
MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDARAAGAAPPGAAPAPGILSSQPGRTPAPSRTSPPPPPAAAAGPAPSPVP
PVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVICVESVNREMSPLV
DSIALWMTEYLNRHLHAWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A076FZV9_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Capra hircus GN=BCL-2 (length=229 residues).
MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDAGAAGAAPPGAAPAPGILSSQPGRTPAPSRTSPPPPPAAAAGPAPSPVP
PVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLV
DSIALWMTEYLNRHLHAWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A452E1B1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Capra hircus GN=BCL2L1 (length=232 residues).
MSQSNRELVVDFLSYKFFQKGYSWSQFSDMEENRTETLEGTESDMETPSAISGNPSWHLADSSVVNGATGHSRSLDAGKM
IPTAVVKQALREASNECELRYQQTFSDLTSQLHITPGTTYQSFEQVINELFQDGVNWCRNVAFFSFGGALCMKSIVKEMQ
VLVSQVTTWMATYLNNHLEPWIQENGDWDIFVELYENNTATESQKGQEHFNRWSLTDVTVAGMALLGLLFNT
>gnl|bcl2dbpro|A0A452ECF0_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Capra hircus GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A452EK63_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Capra hircus GN=BCL2A1 (length=175 residues).
MTDTEFDYVHKLAEDYLKYVLQIQQPGSKPSKTSRVLQDVASSVQDEVERTLKQCLDKFDVVSVDTARTIFNQVMEKEFE
DGIVNWGRIVTIFAFEGILTKKLLSKRIASDMDMCKDISYFVAEFITENTGEWIRQNGGWENGFVKKFETKSGWLTFLEV
TGKICETLCRLKQYY
>gnl|bcl2dbpro|A0A452EV13_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Capra hircus GN=BCL-2 (length=229 residues).
MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDAGAAGAAPPGAAPAPGILSSQPGRAPAPSRTSPPPPPAAAAGPAPSPVP
PVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLV
DSIALWMTEYLNRHLHAWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A452FIG6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Capra hircus GN=BCL2L1 (length=232 residues).
MSQSNRELVVDFLSYKLSQKGFSWSLRRDKIRYGNPNAVNANPSWHLAHSPAVNGATGHTEESGPVATAQQAPREAGSEF
ELRHQQTVSDLTSQLHTTPGTAYQSFEQVMYELFWDGVNWDHTVAFFSFRGALCMESVDKEMQVLVSQVMTWMASQLNDH
LEPWIQENGGWDTSVEFCENNTATESQKGQERFNCWSLTAVTLAGGSGLSRKAAVSKDTPWLTFPSPHAQAY
>gnl|bcl2dbpro|A0A452FIG6_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Capra hircus GN=BCL2L1 (length=240 residues).
MSQSNRELVVDFLSYKLSQKGFSWSLRRDKIRYGNPNAVNANPSWHLAHSPAVNGATGHTEESGPVATAQQAPREAGSEF
ELRHQQTVSDLTSQLHTTPGTAYQSFEQVMYELFWDGVNWDHTVAFFSFRGALCMESVDKEMQVLVSQVMTWMASQLNDH
LEPWIQENGGWDTSVEFCENNTATESQKGQERFNCWSLTAVTLAGLALQLIVTVPFITVIHVLHKLVFPSFCYSYRDLTI
>gnl|bcl2dbpro|A0A452FWV3_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Capra hircus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNPSWHLADSPAVNGATGHSRSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A452GAH0_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Capra hircus GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGKEATARREVGGGEAGTVIGGSAGPSPPATLAPDARRVARPSP
IGAEGPDVTATPTRLLFFAPTRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPAVRPLALMVGEASNNSPGSDGSL
PSTPPPSEEEEDELYRQSLEIISQYLLEQATGAKDAKPLGGSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRSKRDWIVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A452GAH0_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Capra hircus GN=MCL-1 (length=335 residues).
MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGKEATARAGPSPPATLAPDARRVARPSPIGAEGPDVTATPTRL
LFFAPTRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPAVRPLALMVGEASNNSPGSDGSLPSTPPPSEEEEDELY
RQSLEIISQYLLEQATGAKDAKPLGGSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFS
DGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRSKRDWIVKQRGWDGFVEFFHVEDLEGGIRNVLLAF
AGVAGVGAGLAYLIR
© 1998-2019