Dataset for protein Bcl-xL of organism Capra hircus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A452E1B1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Capra hircus GN=BCL2L1 (length=232 residues).
MSQSNRELVVDFLSYKFFQKGYSWSQFSDMEENRTETLEGTESDMETPSAISGNPSWHLADSSVVNGATGHSRSLDAGKM
IPTAVVKQALREASNECELRYQQTFSDLTSQLHITPGTTYQSFEQVINELFQDGVNWCRNVAFFSFGGALCMKSIVKEMQ
VLVSQVTTWMATYLNNHLEPWIQENGDWDIFVELYENNTATESQKGQEHFNRWSLTDVTVAGMALLGLLFNT
>gnl|bcl2dbpro|A0A452FIG6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Capra hircus GN=BCL2L1 (length=232 residues).
MSQSNRELVVDFLSYKLSQKGFSWSLRRDKIRYGNPNAVNANPSWHLAHSPAVNGATGHTEESGPVATAQQAPREAGSEF
ELRHQQTVSDLTSQLHTTPGTAYQSFEQVMYELFWDGVNWDHTVAFFSFRGALCMESVDKEMQVLVSQVMTWMASQLNDH
LEPWIQENGGWDTSVEFCENNTATESQKGQERFNCWSLTAVTLAGGSGLSRKAAVSKDTPWLTFPSPHAQAY
>gnl|bcl2dbpro|A0A452FIG6_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Capra hircus GN=BCL2L1 (length=240 residues).
MSQSNRELVVDFLSYKLSQKGFSWSLRRDKIRYGNPNAVNANPSWHLAHSPAVNGATGHTEESGPVATAQQAPREAGSEF
ELRHQQTVSDLTSQLHTTPGTAYQSFEQVMYELFWDGVNWDHTVAFFSFRGALCMESVDKEMQVLVSQVMTWMASQLNDH
LEPWIQENGGWDTSVEFCENNTATESQKGQERFNCWSLTAVTLAGLALQLIVTVPFITVIHVLHKLVFPSFCYSYRDLTI
>gnl|bcl2dbpro|A0A452FWV3_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Capra hircus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNPSWHLADSPAVNGATGHSRSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
© 1998-2019