Dataset for protein Bcl-2 of organism Capra hircus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A076FU27_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Capra hircus GN=BCL-2 (length=229 residues).
MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDARAAGAAPPGAAPAPGILSSQPGRTPAPSRTSPPPPPAAAAGPAPSPVP
PVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVICVESVNREMSPLV
DSIALWMTEYLNRHLHAWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A076FZV9_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Capra hircus GN=BCL-2 (length=229 residues).
MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDAGAAGAAPPGAAPAPGILSSQPGRTPAPSRTSPPPPPAAAAGPAPSPVP
PVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLV
DSIALWMTEYLNRHLHAWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A452EV13_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Capra hircus GN=BCL-2 (length=229 residues).
MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDAGAAGAAPPGAAPAPGILSSQPGRAPAPSRTSPPPPPAAAAGPAPSPVP
PVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLV
DSIALWMTEYLNRHLHAWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
© 1998-2019