Dataset for protein Mcl-1 of organism Canis lupus familiaris

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|J9PBC4_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Canis lupus familiaris GN=MCL-1 (length=467 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGRLLASGKEATTRREGGGGEAGAVIGGSAGASPPTTLAPDARRVARPS
PIGAEGPNVSATPPRLLLLAPPCRASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASSGPGMDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPLGGSRAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVIVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGGVWGEW
STPSDLKGESRKECCPSWAAEAGRWGADLSLQTVAQWLSPLLSACRNSSAPPSSPLGIVYRTAWATQHTLFLKMILIWFA
LLPPRGPRWPREAWVTTCGTPTPRSGPEAPWEFLSLPATQLFLPFLTKLLLEHSGISAGLKHFVAKR
>gnl|bcl2dbpro|J9PBC4_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Canis lupus familiaris GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGRLLASGKEATTRREGGGGEAGAVIGGSAGASPPTTLAPDARRVARPS
PIGAEGPNVSATPPRLLLLAPPCRASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASSGPGMDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPLGGSRAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVIVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|Q8HYS5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Canis lupus familiaris GN=MCL-1 (length=350 residues).
MFGLKRNAVIRTQLYCGGAGLGAGSGGASSSGGRLLASGREATTRREGGGGEAGAVIGGSAGASPPTTLAPDARRVARPS
PIGAEGPNVSATPPRLLLLAPPCRASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASSGPGMDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPLGGSRAASRKALETLQRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVIVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
© 1998-2019