Dataset for protein Bfl1 of organism Canis lupus familiaris

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|E2RS00_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2A1 (length=174 residues).
MTDCEFGYTLALAQDYVRHVLQIPQPGPAPSRASRVLQDVAFSVQGQVEKNLKPCLDSFDVVSVDTARTIFNQVMEKEFE
DGVINWGRIVTVFAFEGILTKKLLEQRISSDVDAEKVSYFVAEFITRNMRDWIRQNGGWENGFVKKFEPKSGWLTFLEVL
GTVCEMWSHLKQYY
© 1998-2019