Dataset for protein Unclassified of organism Callithrix jacchus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|F7IT36_uncBCL2L1-03 Putative BCL2-like 1 protein OS=[Eukaryota] Callithrix jacchus (length=147 residues).
MWKRTGLRPQKGLIRRWRPPVPSMATHPGTWRTAQCFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRI
AAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
© 1998-2019