Dataset for protein BCL-2-like of organism Callithrix jacchus

[Download (right click)] [Alignment] [Repertoires]

11 sequence(s)

>gnl|bcl2dbpro|A0A2R8M4C0_BCL2L2-04 BCL2-like 2 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L2 (length=214 residues).
LLVLCPYINASLSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGYVCGTGPGEGPAADPLHQAMRAAGDEFETRFRR
TFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
SSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A2R8M4C0_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L2 (length=346 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGTGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKIDFKAFIYSSLTQVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRF
YSGFNSRPRGRVYRGRARATSWYSPY
>gnl|bcl2dbpro|A0A2R8MY14_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Callithrix jacchus GN=BCL-2 (length=240 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAEGIFSSQPGHTPGPAAPRDPVARTSPPPPPAAPAA
AATGPTLSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCV
ESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLVLVGACITLGAYLGHK
>gnl|bcl2dbpro|F7CT87_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L10 (length=226 residues).
MADPLRQRTEQLVTDYLEYCSREPGTPESPPSTAEAAVLRAVAASVRKLYRSFFSAYLGYPGNRVELVARMAEALLSDSP
GPTWGNVVMLLAFAGTLLERGPLVTARWKKWGFQSRLKEPEGDVARDCQRLVALLSSRLVGQHRAWLEAQGGWVSKEGDT
GRDRHLGTARPRWLLLLLQDLLLAGIMEKSAGPGFPVMVVNSSIHLLLDTIMRSFKSFSPLLPAQL
>gnl|bcl2dbpro|F7GTF7_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Callithrix jacchus GN=MCL-1 (length=350 residues).
MFGLQRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASAQREVGGGEAGAVTGGSAGASPPAALTPDARRVVRPP
PIGAEVPDVTATPSRLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEPANGSSTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|F7GTF7_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Callithrix jacchus GN=MCL-1 (length=271 residues).
MFGLQRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASAQREVGGGEAGAVTGGSAGASPPAALTPDARRVVRPP
PIGAEVPDVTATPSRLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEPANGSSTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGWVCGVLPCRG
PRRWHQKCAAGFCGCCWSRSWVGISNKIALE
>gnl|bcl2dbpro|F7GTF7_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Callithrix jacchus GN=MCL-1 (length=197 residues).
MFGLQRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGMLR
KLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWD
GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|F7IT34_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTDSEMETPSAINGNPSWHLADSPVVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|F7IT34_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTDSEMETPSAINGNPSWHLADSPVVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|U3DBA0_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2A1 (length=162 residues).
MTDSEFGYIHNLTQDYLQYVLQIPQSGMGPSKTSRVLQQVAFSVQKEVEKSLKSCLDNVDIASIDNARTIFSQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRERIAPDVDTYKEISHFVAEFIMNNTGEWIRQNGGWGKWHSLMLMLVSVAQKKRKM
AL
>gnl|bcl2dbpro|U3DBA0_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2A1 (length=175 residues).
MTDSEFGYIHNLTQDYLQYVLQIPQSGMGPSKTSRVLQQVAFSVQKEVEKSLKSCLDNVDIASIDNARTIFSQVMEKEFE
DGIINWGRIVTIFAFEGILIKKLLRERIAPDVDTYKEISHFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEV
TGKICEMLSLLKQYC
© 1998-2019