Dataset for protein Bcl-w of organism Callithrix jacchus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A2R8M4C0_BCL2L2-04 BCL2-like 2 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L2 (length=214 residues).
LLVLCPYINASLSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGYVCGTGPGEGPAADPLHQAMRAAGDEFETRFRR
TFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
SSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A2R8M4C0_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L2 (length=346 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGTGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKIDFKAFIYSSLTQVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRF
YSGFNSRPRGRVYRGRARATSWYSPY
© 1998-2019