Dataset for protein BCL-2-like of organism Bufo japonicus formosus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|J7H260_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Bufo japonicus formosus GN=MCL-1 (length=212 residues).
MGGSLPSPQSELDEDEDYMDVQSDSRGSTSPPLTPTCSPDPLHTETRALLHTFFREWAGDAKQEDGDSPKALPTMRRLGG
DINEKHRMAFQGMLQKLSIQRPEDIQKLSEVPSMVFSDGVTNWGRIVTVISFGAFVAKHLKSIHMENCVGILADSFTDYL
MTQKKEWIVEHNGWDGCVEFFHVEDYESGLKTVLMAFAGVAGLGASLAYMIR
© 1998-2019