Dataset for protein Unclassified of organism Bos taurus

[Download (right click)]

3 sequence(s)

>gnl|bcl2dbpro|A0A3Q1MEB8_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Bos taurus (length=173 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDMEENRTETPEGTESDMEIPSAINGNPSWHVADSPAVNGAIGHSRSLDARKM
IPMTTVKQAVREASNEFELRYQQTFSDLTSQLHITPGTAYQSFEQENGDWDTFVELYENNTTESQKSQESFNCWSLMDVS
VAGVVPLGLLFNS
>gnl|bcl2dbpro|A1L569_uncBCL2L2-01 Putative BCL2-like 2 protein OS=[Eukaryota] Bos taurus (length=242 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QTQVLAPAPAPAPGMASTLAQALAPGLAQAVTPPAPRTNQTGEGTLTEALLQLQFDTDEDLGALLGNNTDPAVFTDLASV
DNSEFQQLLNQGVPMGPHTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGPPGLTNGLLSGDEDFSSIADVDFSALLSQI
SS
>gnl|bcl2dbpro|Q05KI9_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Bos taurus (length=170 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNASWHLADSPAVNGATGHSRSSDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGV
VLLGSLFSRK
© 1998-2019