Dataset for protein Mcl-1 of organism Bos taurus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A5PJR2_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Bos taurus GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGKEATARREVGGGEAGTVIGGSAGPSPPATLAPDARRVARPSP
IGAEGPDVTATPTRLLFFAPTRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPAVRPLPLLVGEASNNSPGSDGSL
PSTPPPAEEEEDELYRQSLEIISQYLREQATGAKDAKPLGGSGTTSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRSKRDWIVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|F1MQX4_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Bos taurus GN=MCL-1 (length=190 residues).
GMLPIFSEEEEDELYWQSLEIISRYLREQATGAKDVKPLGGSGATSRKALETLHRVGDGVQHNHETAFQGMLQKLDIKNE
DDVKSLSRVMVHVFSDRVTNWGRIVTLISFGAFVAKHFKSINQESCIEPLAESITDVLVRSKRDWIVKERGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
© 1998-2019