Dataset for protein BCL-2-like of organism Bos taurus

[Download (right click)] [Alignment] [Repertoires]

12 sequence(s)

>gnl|bcl2dbpro|A0A3Q1LRT3_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Bos taurus GN=BCL2L1 (length=237 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSVRYGNPQWISGNPSWHLADSPTVNGATGHSRSLDARKMIPMTTVKQALREAS
NEFKLRYQQTFSDLMSQLRITPGTACQSFEQVINELFRDRVKWGHVVAFFSFSGTLCMKSIDKEIHVLVSQVTTSTATYL
NNHLKPWIQENGGWDTFVELYESNTTNESQKGQERFNCWSLTTRLWLFGIFLIKHIFTKQPSNCTLEHLSGRYATLL
>gnl|bcl2dbpro|A5PJR2_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Bos taurus GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGKEATARREVGGGEAGTVIGGSAGPSPPATLAPDARRVARPSP
IGAEGPDVTATPTRLLFFAPTRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPAVRPLPLLVGEASNNSPGSDGSL
PSTPPPAEEEEDELYRQSLEIISQYLREQATGAKDAKPLGGSGTTSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRSKRDWIVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|E1B9B3_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Bos taurus GN=BCL2L10 (length=248 residues).
MTEGGAMVDPFRERTARLLMDYLEFCAREPGTPAPAPSTPEAAVLRHVAARIQEANRNVLPLYRRCRRHRVELVARMAQR
LLDEDPGPSWGRVASLVTFAGSLLERPPQTTRRQEKRDDDGVSRDCRLLVALLCAQFCERHRAWLMTNGGWVSAKDAGLV
GSLGRAHAAGWILSLLQPLIPAILGKTAGLVFPLILDSNNHNLLLDKIIVSSKILISTCLTLSNQAKLKCERPNQSKPPS
ETFLSAFM
>gnl|bcl2dbpro|F1MQX4_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Bos taurus GN=MCL-1 (length=190 residues).
GMLPIFSEEEEDELYWQSLEIISRYLREQATGAKDVKPLGGSGATSRKALETLHRVGDGVQHNHETAFQGMLQKLDIKNE
DDVKSLSRVMVHVFSDRVTNWGRIVTLISFGAFVAKHFKSINQESCIEPLAESITDVLVRSKRDWIVKERGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|F1MV39_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Bos taurus GN=BCL2L10 (length=187 residues).
VADGQESLVERTARLLMDYLEFCAREPGTPAPAPSTPEAAVLRHVAARIQEANRNVLPLYRRCRRHRVELVARMAQRLLD
EDPGPSWGRVASLVTFAGSLLERPPQTTRRQKRDDDGVSRDCRLLVALLCAQFCERHRAWLMANGGWDGFCLFFSQSFQP
SWERQLVWFFLAYWTAIIIIYFWIKLL
>gnl|bcl2dbpro|F6R2C4_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Bos taurus GN=BCL-2 (length=229 residues).
MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGILSSQPGRTPAPSRTSPPPPPAAAAGPAPSPVP
PVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLV
DSIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|O02718_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Bos taurus GN=BCL-2 (length=229 residues).
MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGILSSQPGRTPAPSRTSPPPPPAAAAGPAPSPVP
PVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARERFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLV
DSIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|Q05KI8_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Bos taurus GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGVGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|Q05KJ0_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Bos taurus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNASWHLADSPAVNGATGHSRSSDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|Q05KJ0_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Bos taurus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNASWHLADSPAVNGATGHSRSSDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|Q1RMX3_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Bos taurus GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|Q3C2I0_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Bos taurus GN=BCL2A1 (length=175 residues).
MTDTEFGYVHGLAEDYLKYVLQIQQPGSKPSKTSRVLQDVASSVQDEVERTLKQCLDKFDVVSVDTARTIFNQVMEKEFE
DGIVNWGRIVTIFAFEGILTKKLLGKCIASDMDMCKDISFFVAEFITENTGEWIKQNGGWENGFVKKFETKSGWLTFLEV
TGKICETLCRLKQYY
© 1998-2019