Dataset for protein Bcl2l10 of organism Bos taurus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|E1B9B3_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Bos taurus GN=BCL2L10 (length=248 residues).
MTEGGAMVDPFRERTARLLMDYLEFCAREPGTPAPAPSTPEAAVLRHVAARIQEANRNVLPLYRRCRRHRVELVARMAQR
LLDEDPGPSWGRVASLVTFAGSLLERPPQTTRRQEKRDDDGVSRDCRLLVALLCAQFCERHRAWLMTNGGWVSAKDAGLV
GSLGRAHAAGWILSLLQPLIPAILGKTAGLVFPLILDSNNHNLLLDKIIVSSKILISTCLTLSNQAKLKCERPNQSKPPS
ETFLSAFM
>gnl|bcl2dbpro|F1MV39_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Bos taurus GN=BCL2L10 (length=187 residues).
VADGQESLVERTARLLMDYLEFCAREPGTPAPAPSTPEAAVLRHVAARIQEANRNVLPLYRRCRRHRVELVARMAQRLLD
EDPGPSWGRVASLVTFAGSLLERPPQTTRRQKRDDDGVSRDCRLLVALLCAQFCERHRAWLMANGGWDGFCLFFSQSFQP
SWERQLVWFFLAYWTAIIIIYFWIKLL
© 1998-2019