Dataset for protein Bcl-xL of organism Bos taurus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A3Q1LRT3_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Bos taurus GN=BCL2L1 (length=237 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSVRYGNPQWISGNPSWHLADSPTVNGATGHSRSLDARKMIPMTTVKQALREAS
NEFKLRYQQTFSDLMSQLRITPGTACQSFEQVINELFRDRVKWGHVVAFFSFSGTLCMKSIDKEIHVLVSQVTTSTATYL
NNHLKPWIQENGGWDTFVELYESNTTNESQKGQERFNCWSLTTRLWLFGIFLIKHIFTKQPSNCTLEHLSGRYATLL
>gnl|bcl2dbpro|Q05KJ0_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Bos taurus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNASWHLADSPAVNGATGHSRSSDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|Q05KJ0_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Bos taurus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNASWHLADSPAVNGATGHSRSSDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
© 1998-2019