Dataset for protein BCL-2-like of organism Bos mutus grunniens

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A4P8GLJ2_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Bos mutus grunniens GN=BCL-2 (length=229 residues).
MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGILSSQPGRTPAPSRTSPPPPPAAAAGPAPSPVP
PVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLV
DSIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
© 1998-2019