Dataset for protein Unclassified of organism Azumapecten farreri

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A0C4XXZ0_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Azumapecten farreri (length=225 residues).
MATEGIQMGSNYPVKGNLFAEIHKQLGLMPGFQGLGQDMSKLDQQTQTPGSASPLEKIRHESEVIAADVISSFGLEECKK
PVDRYCKTMRRTVRELSDRHDIAFKGMVNKLNVDDSNAFPTFVSVVDEIFEDGQINWGRIVAVYTFASRLALHCRVNTPD
CDEKIALYAGKYVASKLGRWILDNGGWDAFADYFPEQGAMEDKLWKGLVYTAMGLGALATMVATR
© 1998-2019