Dataset for protein Unclassified of organism Atta cephalotes

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A158N8X4_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Atta cephalotes (length=322 residues).
MRCENGASPRKLEKTLENGSDLDGGEEWRLVGMVPCSSPVREKRMAGDDGTTTNNEILGAEGGEEEQGTSARGELHSRVG
GILECDPPGNRNSSNERPAATAAANNEDGVCRYAVGAANRAMSFFEMCQIRLQYLFPQLSPPPRYNIHDDSIESTAEILA
NDVMRYLLKEDIYLISQDPVSRSMRHNVYQMLNKHSILFTSMVNRLNVVPDTAYETFMGVANELFLHGVITWARIVCLYA
FMGRLALWARDRRMHSLKKKLPLYVSRYVGENITHFIKGYGGWEQLCVEYPVAEEVSGAVWRSLLMTGATLGLIATILSV
TS
© 1998-2019