Dataset for protein Unclassified of organism Astyanax mexicanus

[Download (right click)]

3 sequence(s)

>gnl|bcl2dbpro|A0A3B1J8Y8_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Astyanax mexicanus (length=207 residues).
KEEKLPRTERPDRGLEGLQSAKGASMGGGSLPDSPRADEDFIPDFSCRCPGFYRGYLGQKPREQSPALRTMSRVVAGVVF
KHGIAYNGMVQKLNLEEQDDSMDFISSVAKTLFSDGNHELRILSLVASVCVDMLKKEESRSLHHLYHFASLISLIFVCVC
VYNVCVFVLQEGFVEFSEVKGQNLLVKSLKAVSRVAGLGFSMFLLHW
>gnl|bcl2dbpro|A0A3B1JPB0_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Astyanax mexicanus (length=218 residues).
MANESPYDSRDIVEKYLYHKLLKRGYVWEFRPASAAASATAAAANSTSAASADDDNDDEAEPERAGPARLHRLLREAGDE
LERVYQRDFAAMWDQLRVGPSAQLQRSFVAVAEELFGDGVNWGRVVAFFEFGGTLCVESVNREMASQVEHIARWMTDYLN
GPLLQSWIQDNGGWDGFVEIYSQQRRSIFHPWPYLKTVFGLAALGAAGVTIGALFTQK
>gnl|bcl2dbpro|W5K2Q2_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Astyanax mexicanus (length=201 residues).
MASKNDMVVYDSRGIVENYLHHKLAKSGHARGEEEEEDEEEEGKRVHPAPPAVHGALREAGDELERLYRSDLTDMTGRLE
LEPAGARRSFAAVADELFRDGVNWGRIVAFLEFGAAVCVERKRTAAEGITADVARWMTEYLNGPVLRGWIRENGGWDAFV
DLYGRQKDSVFGSSWPSIVTVFSLAALGAVGFTIGAYLAQK
© 1998-2019