Dataset for protein Mcl-1 of organism Astyanax mexicanus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3B1IEV7_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Astyanax mexicanus GN=MCL-1 (length=242 residues).
MNPTAISLLCDGTSPVLYRTEKEEKLPRTERPERGLEGLQSAKGVSMGGGSLPDSPLADVDFIQDFSCRCPGALEAETRR
LMVEFYRGYLGQKPREQSPALRTMSRVVAGVVLKHGIAYNGMVQKLNLEEQDDSMDIISSVAKALFSDGTTNWGRIVSLV
AFGAVVCDHLKKKSRDHCVENVAQHISTYLNTHQHQWLINNNAWDGFVEFFREDDSESRVRNALMAFAGFAGLGAGLALL
MR
>gnl|bcl2dbpro|A0A3B1K5R1_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Astyanax mexicanus GN=MCL-1 (length=244 residues).
MMSPQDMCSYNKKTADIVPRVAVRGGGGGAGLSLGLAADIRPTRPGVDDGSVPSSPLSDCGEMAVGNCKQYETLDGDTRE
IISDFLRNFCGLSRSCGGHGAVVQTMKRVVDDLVVKHGIAYKGMLNKLGMEDRGDDMYVIRAVAKELFSDGITNWGRVAS
LVAFGAVVSKHQHDMGRGHCVSLVGEELSSYLLSDERDWLLKNKAWDGFVEFFRVPDPESTMRNALMAFVTVAGLGASIA
FLAR
© 1998-2019