Dataset for protein Bcl-xL of organism Astyanax mexicanus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3B1JJ42_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Astyanax mexicanus GN=BCL2L1 (length=239 residues).
VMSYYNRELVVYFIKYKLSQRNYPTNHIGLMEETNRTEGGQEAEGNAEAAGVTPTAVVNGSVNGTSHGAAGSPTSSPQRR
ANGARGLDAVKEALRDSANEFELRYSRAFSDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVE
KEMSPLVGRIAEWMTVYLDNHIQPWIQEQGGWERFAEIFGNDTAAESRRMQERYKMWLLVGMTLFTGIVVGSLIAQKRL
© 1998-2019