Dataset for protein Mcl-1 of organism Astatotilapia calliptera

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A3P8NP63_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Astatotilapia calliptera GN=MCL-1 (length=274 residues).
MANYMMLKRNQCTLMEYLIPQNGVLEGPMHYGSGNSSPQNATGSSKDSSNGIVSNGTPKRPDNLEVTSTNGYKTKAIRDR
EEDGSLPSTPEFHSDSESDEQLERETKLLIHSFLGDFIGLSQPQRKETKALKTMKRVVADVLEKHRYAYNGMINKLSLDE
RDEDMSFVGAVAKSLFGDHTTNWGRIVSFMAFGAVVSQHLKEKGRDNYVALVSQEISAYLLSEQRDWIVKNNAWDGFVEF
FRVADPESIVRHTLMAFAGFAGIGATLALLISGL
>gnl|bcl2dbpro|A0A3P8NP63_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Astatotilapia calliptera GN=MCL-1 (length=277 residues).
MANYMMLKRNQCTLMEYLIPQNGVLEGPMHYGSGNSSPQNATGSSKDSSNGIVSNGTPKRPDNLEVTSTNGYKTKAIRDR
EEDGSLPSTPEFHSDSESDEQLERETKLLIHSFLGDFIGLSQPQRKETKALKTMKRVVADVLEKHRYAYNGMINKLSLDE
RDEDMSFVGAVAKSLFGDHTTNWGRIVSFMAFGAVVSQHLKEKGRDNYVALVSQEISAYLLSEQRDWIVKNNAWDGFVEF
FRVADPESIVRHTLMAFAGFAGIGATLALLIRSSTIF
>gnl|bcl2dbpro|A0A3P8NP63_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Astatotilapia calliptera GN=MCL-1 (length=278 residues).
MANYMMLKRNQCTLMEYLIPQNGVLEGPMHYGSGNSSPQNATGSSKDSSNGIVSNGTPKRPDNLEVTSTNGYKTKAIRDR
EEDGSLPSTPEFHSDSESDEQLERETKLLIHSFLGDFIGLSQPQRKETKALKTMKRVVADVLEKHRYAYNGMINKLSLDE
RDEDMSFVGAVAKSLFGDHTTNWGRIVSFMAFGAVVSQHLKEKGRDNYVALVSQEISAYLLSEQRDWIVKNNAWDGFVEF
FRVADPESIVRHTLMAFAGFAGIGATLALLISCWDALL
© 1998-2019